PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG080800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CO-like
Protein Properties Length: 385aa    MW: 39282 Da    PI: 7.1754
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG080800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.21.1e-051554440
             zf-B_box  4 rkCpeHeekelqlfCedC..qqllCedClleeHkg..Htvv 40
                         r+C  ++  ++  +C++C  + +lC+ C  e H +  H++v
  Pavir.1KG080800.1.p 15 RRCGACGGSPAAAHCRTCpgGAYLCAGCDAE-HARagHERV 54
                         79****************7778*********.*77889875 PP

2zf-B_box24.27.2e-085499342
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                          ++C+ +e+ ++   C+ +   lC+ C   +H        H++vp+
  Pavir.1KG080800.1.p 54 VWVCEVCERAPAAVTCRADAAALCAACDADIHDAnplarrHERVPV 99
                         689*****************************44788888999986 PP

3CCT713e-24290333144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea+l+RY+eKrk+R+FeK+irY+sRKa+AesRpRvKGrF+k+a
  Pavir.1KG080800.1.p 290 REARLMRYREKRKNRRFEKTIRYASRKAYAESRPRVKGRFAKRA 333
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0341256IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8655299IPR000315B-box-type zinc finger
PfamPF006438.3E-65399IPR000315B-box-type zinc finger
SMARTSM003367.9E-95799IPR000315B-box-type zinc finger
PROSITE profilePS5101716.986290332IPR010402CCT domain
PfamPF062036.0E-18290332IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MEVGLAAGYW GVGGRRCGAC GGSPAAAHCR TCPGGAYLCA GCDAEHARAG HERVWVCEVC  60
ERAPAAVTCR ADAAALCAAC DADIHDANPL ARRHERVPVQ PIGAAAPAVD PLLFSAVVAE  120
EKDADAALAG MLAGRAVGGA NSKVNGKLDF LFTDVMDPFL GQGFARFVHA DSVVPSNGPI  180
GGALDLDFGG AAAAAVATKP SYSSYTAASL GHSGSSSEVG LVPDAICGRG GSVTGGVIEL  240
DFAQSKAGYL PYAAATPTHS VSSLDAGAVP DRSDGGVVGS RVAAAAVESR EARLMRYREK  300
RKNRRFEKTI RYASRKAYAE SRPRVKGRFA KRADDNDADA DAEAAGFPNA ATAAAAPPPK  360
QPQPAAYHSY VLDFAAGYGV VPTF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.41834e-34callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096301e-52AK109630.1 Oryza sativa Japonica Group cDNA clone:002-138-D02, full insert sequence.
GenBankAP0048381e-52AP004838.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0504A05.
GenBankAP0149581e-52AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126101e-52CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951711.11e-155PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLK3YT921e-155K3YT92_SETIT; Uncharacterized protein
STRINGSi017487m1e-155(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.19e-16CONSTANS-like 5